Lineage for d1dfla1 (1dfl A:29-76)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13205Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 13206Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 13207Protein Myosin S1 fragment, N-terminal domain [50086] (3 species)
  7. 13208Species Bay scallop (Aequipecten irradians) [TaxId:31199] [50088] (3 PDB entries)
  8. 13211Domain d1dfla1: 1dfl A:29-76 [24574]
    Other proteins in same PDB: d1dfla2, d1dflb2, d1dflw_, d1dflx_, d1dfly_, d1dflz_

Details for d1dfla1

PDB Entry: 1dfl (more details), 4.2 Å

PDB Description: scallop myosin s1 complexed with mgadp:vanadate-transition state

SCOP Domain Sequences for d1dfla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfla1 b.34.3.1 (A:29-76) Myosin S1 fragment, N-terminal domain {Bay scallop (Aequipecten irradians)}
dgkkncwvpdekegfasaeiqsskgdeitvkivadsstrtvkkddiqs

SCOP Domain Coordinates for d1dfla1:

Click to download the PDB-style file with coordinates for d1dfla1.
(The format of our PDB-style files is described here.)

Timeline for d1dfla1: