Lineage for d3dypd3 (3dyp D:334-625)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2095300Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2095301Protein automated matches [190075] (90 species)
    not a true protein
  7. 2095451Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)
  8. 2095459Domain d3dypd3: 3dyp D:334-625 [245736]
    Other proteins in same PDB: d3dypa1, d3dypa2, d3dypa4, d3dypa5, d3dypb1, d3dypb2, d3dypb4, d3dypb5, d3dypc1, d3dypc2, d3dypc4, d3dypc5, d3dypd1, d3dypd2, d3dypd4, d3dypd5
    automated match to d1jz7a5
    complexed with dms, mg, na

Details for d3dypd3

PDB Entry: 3dyp (more details), 1.75 Å

PDB Description: e. coli (lacz) beta-galactosidase (h418n)
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d3dypd3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dypd3 c.1.8.0 (D:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeanietngmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3dypd3:

Click to download the PDB-style file with coordinates for d3dypd3.
(The format of our PDB-style files is described here.)

Timeline for d3dypd3: