| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.4: beta-Galactosidase/glucuronidase domain [49303] (2 families) ![]() |
| Family b.1.4.0: automated matches [254272] (1 protein) not a true family |
| Protein automated matches [254633] (19 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255790] (18 PDB entries) |
| Domain d3dymb4: 3dym B:626-730 [245687] Other proteins in same PDB: d3dyma1, d3dyma3, d3dyma5, d3dymb1, d3dymb3, d3dymb5, d3dymc1, d3dymc3, d3dymc5, d3dymd1, d3dymd3, d3dymd5 automated match to d1jz8a2 complexed with dms, mg, na |
PDB Entry: 3dym (more details), 2.05 Å
SCOPe Domain Sequences for d3dymb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dymb4 b.1.4.0 (B:626-730) automated matches {Escherichia coli K-12 [TaxId: 83333]}
ffqfrlsgqtievtseylfrhsdnellhwmvaldgkplasgevpldvapqgkqlielpel
pqpesagqlwltvrvvqpnatawseaghisawqqwrlaenlsvtl
Timeline for d3dymb4:
View in 3DDomains from same chain: (mouse over for more information) d3dymb1, d3dymb2, d3dymb3, d3dymb5 |