| Class b: All beta proteins [48724] (180 folds) |
| Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) ![]() probable carbohydrate-binding domain in enzymes acting on sugars |
| Family b.30.5.0: automated matches [227145] (1 protein) not a true family |
| Protein automated matches [226849] (8 species) not a true protein |
| Species Escherichia coli K-12 [TaxId:83333] [255791] (18 PDB entries) |
| Domain d3dymc5: 3dym C:731-1023 [245693] Other proteins in same PDB: d3dyma1, d3dyma2, d3dyma3, d3dyma4, d3dymb1, d3dymb2, d3dymb3, d3dymb4, d3dymc1, d3dymc2, d3dymc3, d3dymc4, d3dymd1, d3dymd2, d3dymd3, d3dymd4 automated match to d1jz8a4 complexed with dms, mg, na |
PDB Entry: 3dym (more details), 2.05 Å
SCOPe Domain Sequences for d3dymc5:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dymc5 b.30.5.0 (C:731-1023) automated matches {Escherichia coli K-12 [TaxId: 83333]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d3dymc5:
View in 3DDomains from same chain: (mouse over for more information) d3dymc1, d3dymc2, d3dymc3, d3dymc4 |