Lineage for d1br4a1 (1br4 A:34-79)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2393289Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) (S)
  5. 2393290Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 2393291Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 2393305Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [50087] (4 PDB entries)
  8. 2393317Domain d1br4a1: 1br4 A:34-79 [24568]
    Other proteins in same PDB: d1br4a2, d1br4b_, d1br4c2, d1br4d_, d1br4e2, d1br4f_, d1br4g2, d1br4h_
    complexed with adp, bef, mg

Details for d1br4a1

PDB Entry: 1br4 (more details), 3.62 Å

PDB Description: smooth muscle myosin motor domain-essential light chain complex with mgadp.bef3 bound at the active site
PDB Compounds: (A:) myosin

SCOPe Domain Sequences for d1br4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1br4a1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
lvwvpsekhgfeaasikeekgdevtvelqengkkvtlskddiqkmn

SCOPe Domain Coordinates for d1br4a1:

Click to download the PDB-style file with coordinates for d1br4a1.
(The format of our PDB-style files is described here.)

Timeline for d1br4a1: