| Class b: All beta proteins [48724] (178 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) ![]() |
| Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein) |
| Protein Myosin S1 fragment, N-terminal domain [50086] (4 species) |
| Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [50087] (4 PDB entries) |
| Domain d1br1c1: 1br1 C:34-79 [24565] Other proteins in same PDB: d1br1a2, d1br1b_, d1br1c2, d1br1d_, d1br1e2, d1br1f_, d1br1g2, d1br1h_ complexed with adp, alf, mg |
PDB Entry: 1br1 (more details), 3.5 Å
SCOPe Domain Sequences for d1br1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1br1c1 b.34.3.1 (C:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
lvwvpsekhgfeaasikeekgdevtvelqengkkvtlskddiqkmn
Timeline for d1br1c1: