SCOPe 2.08: Domain d3dnfb_: 3dnf B:

Lineage for d3dnfb_ (3dnf B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.155: LytB-like [254115] (1 superfamily)
   duplication; consists of three similar domains related by pseudo threefold symmetry, surrounding Fe-S cluster; 3 layers, a/b/a; parallel beta sheet, order: 2134

4. Superfamily c.155.1: LytB-like [254137] (1 family)
   PubMed 19035630; Pfam PF02401

5. Family c.155.1.1: LytB-like [254180] (1 protein)

6. Protein LytB [254403] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [254839] (1 PDB entry)

8. Domain d3dnfb_: 3dnf B: [245648]
   complexed with f3s, gol

Details for d3dnfb_

PDB Entry: 3dnf, 1.65 Å

PDB Description: structure of (e)-4-hydroxy-3-methyl-but-2-enyl diphosphate reductase, the terminal enzyme of the non-mevalonate pathway

PDB Compounds: (B:) 4-hydroxy-3-methylbut-2-enyl diphosphate reductase

SCOPe Domain Sequences for d3dnfb_:

Sequence; same for both SEQRES and ATOM records:

>d3dnfb_ c.155.1.1 (B:) LytB {Aquifex aeolicus [TaxId: 63363]}
mvdiiiaehagfcfgvkravklaeeslkesqgkvytlgpiihnpqevnrlknlgvfpsqg
eefkegdtviirshgippekeealrkkglkvidatcpyvkavheavcqltregyfvvlvg
eknhpevigtlgylracngkgivvetledigealkhervgivaqttqneeffkevvgeia
lwvkevkvinticnatslrqesvkklapevdvmiiiggknsgntrrlyyiskelnpntyh
ietaeelqpewfrgvkrvgisagastpdwiieqvksriqeic

Timeline for d3dnfb_:

• d3dnfb_ first appeared in SCOPe 2.04
  
• d3dnfb_ appears in SCOPe 2.07