Lineage for d1br1a1 (1br1 A:34-79)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536746Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (2 families) (S)
  5. 1536747Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 1536748Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 1536762Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [50087] (4 PDB entries)
  8. 1536770Domain d1br1a1: 1br1 A:34-79 [24564]
    Other proteins in same PDB: d1br1a2, d1br1b_, d1br1c2, d1br1d_, d1br1e2, d1br1f_, d1br1g2, d1br1h_
    complexed with adp, alf, mg

Details for d1br1a1

PDB Entry: 1br1 (more details), 3.5 Å

PDB Description: smooth muscle myosin motor domain-essential light chain complex with mgadp.alf4 bound at the active site
PDB Compounds: (A:) myosin

SCOPe Domain Sequences for d1br1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1br1a1 b.34.3.1 (A:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
lvwvpsekhgfeaasikeekgdevtvelqengkkvtlskddiqkmn

SCOPe Domain Coordinates for d1br1a1:

Click to download the PDB-style file with coordinates for d1br1a1.
(The format of our PDB-style files is described here.)

Timeline for d1br1a1: