SCOPe 2.04: Domain d3dfvc_: 3dfv C:

Lineage for d3dfvc_ (3dfv C:)

1. Root: SCOPe 2.04

2. Class g: Small proteins [56992] (91 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.1: Erythroid transcription factor GATA-1 [57717] (2 proteins)
   single zinc-binding motif

6. Protein automated matches [190940] (2 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188496] (2 PDB entries)

8. Domain d3dfvc_: 3dfv C: [245634]
   automated match to d1gata_
   complexed with zn

Details for d3dfvc_

PDB Entry: 3dfv, 3.1 Å

PDB Description: adjacent gata dna binding

PDB Compounds: (C:) Trans-acting T-cell-specific transcription factor GATA-3

SCOPe Domain Sequences for d3dfvc_:

Sequence; same for both SEQRES and ATOM records:

>d3dfvc_ g.39.1.1 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rragtscancqtttttlwrrnangdpvcnacglyyklhninrpltmkkegiqtrnr

Timeline for d3dfvc_:

• d3dfvc_ is new in SCOPe 2.04-stable
  
• d3dfvc_ appears in SCOPe 2.05
  
• d3dfvc_ appears in the current release, SCOPe 2.08