| Class b: All beta proteins [48724] (176 folds) |
| Fold b.23: CUB-like [49853] (4 superfamilies) sandwich, 10 strands in 2 sheets; jelly-roll |
Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) ![]() automatically mapped to Pfam PF00431 |
| Family b.23.1.0: automated matches [254288] (1 protein) not a true family |
| Protein automated matches [254671] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [255797] (1 PDB entry) |
| Domain d3demb1: 3dem B:7-120 [245629] Other proteins in same PDB: d3dema2, d3demb2 automated match to d1nt0a1 complexed with ca, nag |
PDB Entry: 3dem (more details), 2.3 Å
SCOPe Domain Sequences for d3demb1:
Sequence, based on SEQRES records: (download)
>d3demb1 b.23.1.0 (B:7-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nmfgqiqspgypdsypsdsevtwnitvpdgfriklyfmhfnlessylceydyvkvetedq
vlatfcgrettdteqtpgqevvlspgsfmsitfrsdfsneerftgfdahymavd
>d3demb1 b.23.1.0 (B:7-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nmfgqiqspgypdsypsdsevtwnitvpdgfriklyfmhfnlessylceydyvkvetedq
vlatfcgrettdqtpgqevvlspgsfmsitfrsdfsneerftgfdahymavd
Timeline for d3demb1: