Lineage for d3dema3 (3dem A:166-278)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387375Fold b.23: CUB-like [49853] (3 superfamilies)
    sandwich, 10 strands in 2 sheets; jelly-roll
  4. 2387376Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families) (S)
    automatically mapped to Pfam PF00431
  5. 2387421Family b.23.1.0: automated matches [254288] (1 protein)
    not a true family
  6. 2387422Protein automated matches [254671] (1 species)
    not a true protein
  7. 2387423Species Human (Homo sapiens) [TaxId:9606] [255797] (4 PDB entries)
  8. 2387425Domain d3dema3: 3dem A:166-278 [245628]
    Other proteins in same PDB: d3dema2, d3demb2
    automated match to d1nt0a2
    complexed with ca, nag

Details for d3dema3

PDB Entry: 3dem (more details), 2.3 Å

PDB Description: cub1-egf-cub2 domain of human masp-1/3
PDB Compounds: (A:) Complement factor MASP-3

SCOPe Domain Sequences for d3dema3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dema3 b.23.1.0 (A:166-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
csdnlftqrtgvitspdfpnpypksseclytieleegfmvnlqfedifdiedhpevpcpy
dyikikvgpkvlgpfcgekapepistqshsvlilfhsdnsgenrgwrlsyraa

SCOPe Domain Coordinates for d3dema3:

Click to download the PDB-style file with coordinates for d3dema3.
(The format of our PDB-style files is described here.)

Timeline for d3dema3: