SCOPe 2.07: Domain d3dema3: 3dem A:166-278

Lineage for d3dema3 (3dem A:166-278)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.23: CUB-like [49853] (3 superfamilies)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families)
   automatically mapped to Pfam PF00431

5. Family b.23.1.0: automated matches [254288] (1 protein)
   not a true family

6. Protein automated matches [254671] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [255797] (4 PDB entries)

8. Domain d3dema3: 3dem A:166-278 [245628]
   Other proteins in same PDB: d3dema2, d3demb2
   automated match to d1nt0a2
   complexed with ca, nag

Details for d3dema3

PDB Entry: 3dem, 2.3 Å

PDB Description: cub1-egf-cub2 domain of human masp-1/3

PDB Compounds: (A:) Complement factor MASP-3

SCOPe Domain Sequences for d3dema3:

Sequence; same for both SEQRES and ATOM records:

>d3dema3 b.23.1.0 (A:166-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
csdnlftqrtgvitspdfpnpypksseclytieleegfmvnlqfedifdiedhpevpcpy
dyikikvgpkvlgpfcgekapepistqshsvlilfhsdnsgenrgwrlsyraa

Timeline for d3dema3:

• d3dema3 first appeared in SCOPe 2.04
  
• d3dema3 appears in SCOPe 2.06
  
• d3dema3 appears in the current release, SCOPe 2.08