Lineage for d3dbsa2 (3dbs A:357-522)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1529155Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1529156Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) (S)
    two constituent families are related by circular permutation
  5. 1529361Family b.7.1.0: automated matches [191388] (1 protein)
    not a true family
  6. 1529362Protein automated matches [190497] (3 species)
    not a true protein
  7. 1529363Species Human (Homo sapiens) [TaxId:9606] [188711] (19 PDB entries)
  8. 1529378Domain d3dbsa2: 3dbs A:357-522 [245621]
    Other proteins in same PDB: d3dbsa1, d3dbsa3, d3dbsa4
    automated match to d1e8wa2
    complexed with gd9

Details for d3dbsa2

PDB Entry: 3dbs (more details), 2.8 Å

PDB Description: Structure of PI3K gamma in complex with GDC0941
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3dbsa2:

Sequence, based on SEQRES records: (download)

>d3dbsa2 b.7.1.0 (A:357-522) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycgkapalsskasaespsseskgkvqllyyvnlllidhrfllr
rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldn

Sequence, based on observed residues (ATOM records): (download)

>d3dbsa2 b.7.1.0 (A:357-522) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef
sikikdlpkgallnlqiycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatn
pdkensmsisilldn

SCOPe Domain Coordinates for d3dbsa2:

Click to download the PDB-style file with coordinates for d3dbsa2.
(The format of our PDB-style files is described here.)

Timeline for d3dbsa2: