Class b: All beta proteins [48724] (176 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.1: C2 domain (Calcium/lipid-binding domain, CaLB) [49562] (3 families) two constituent families are related by circular permutation |
Family b.7.1.0: automated matches [191388] (1 protein) not a true family |
Protein automated matches [190497] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188711] (19 PDB entries) |
Domain d3dbsa2: 3dbs A:357-522 [245621] Other proteins in same PDB: d3dbsa1, d3dbsa3, d3dbsa4 automated match to d1e8wa2 complexed with gd9 |
PDB Entry: 3dbs (more details), 2.8 Å
SCOPe Domain Sequences for d3dbsa2:
Sequence, based on SEQRES records: (download)
>d3dbsa2 b.7.1.0 (A:357-522) automated matches {Human (Homo sapiens) [TaxId: 9606]} cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef sikikdlpkgallnlqiycgkapalsskasaespsseskgkvqllyyvnlllidhrfllr rgeyvlhmwqisgkgedqgsfnadkltsatnpdkensmsisilldn
>d3dbsa2 b.7.1.0 (A:357-522) automated matches {Human (Homo sapiens) [TaxId: 9606]} cdrkfrvkirgidipvlprntdltvfveaniqhgqqvlcqrrtspkpfteevlwnvwlef sikikdlpkgallnlqiycllyyvnlllidhrfllrrgeyvlhmwqisgfnadkltsatn pdkensmsisilldn
Timeline for d3dbsa2: