Lineage for d1br2e1 (1br2 E:34-79)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 796060Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 796467Superfamily b.34.3: Myosin S1 fragment, N-terminal domain [50084] (1 family) (S)
  5. 796468Family b.34.3.1: Myosin S1 fragment, N-terminal domain [50085] (1 protein)
  6. 796469Protein Myosin S1 fragment, N-terminal domain [50086] (4 species)
  7. 796483Species Chicken (Gallus gallus), pectoral muscle [TaxId:9031] [50087] (4 PDB entries)
  8. 796488Domain d1br2e1: 1br2 E:34-79 [24562]
    Other proteins in same PDB: d1br2a2, d1br2b2, d1br2c2, d1br2d2, d1br2e2, d1br2f2

Details for d1br2e1

PDB Entry: 1br2 (more details), 2.9 Å

PDB Description: smooth muscle myosin motor domain complexed with mgadp.alf4
PDB Compounds: (E:) myosin

SCOP Domain Sequences for d1br2e1:

Sequence, based on SEQRES records: (download)

>d1br2e1 b.34.3.1 (E:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
lvwvpsekhgfeaasikeekgdevtvelqengkkvtlskddiqkmn

Sequence, based on observed residues (ATOM records): (download)

>d1br2e1 b.34.3.1 (E:34-79) Myosin S1 fragment, N-terminal domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]}
lvwvpsekhgfeaasievtvelqengkkvtlskddiqkmn

SCOP Domain Coordinates for d1br2e1:

Click to download the PDB-style file with coordinates for d1br2e1.
(The format of our PDB-style files is described here.)

Timeline for d1br2e1: