PDB entry 1br2

View 1br2 on RCSB PDB site
Description: smooth muscle myosin motor domain complexed with mgadp.alf4
Class: muscle protein
Keywords: muscle protein
Deposited on 1998-08-26, released 1998-09-09
The last revision prior to the SCOP 1.75 freeze date was dated 2003-09-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.232
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: myosin
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1br2a1, d1br2a2
  • Chain 'B':
    Compound: myosin
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1br2b1, d1br2b2
  • Chain 'C':
    Compound: myosin
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1br2c1, d1br2c2
  • Chain 'D':
    Compound: myosin
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1br2d1, d1br2d2
  • Chain 'E':
    Compound: myosin
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1br2e1, d1br2e2
  • Chain 'F':
    Compound: myosin
    Species: GALLUS GALLUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1br2f1, d1br2f2
  • Heterogens: MG, ALF, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1br2A (A:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllqanpileafgnaktvk
    ndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqm
    rndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlq
    lgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtke
    qadfaiealakakferlfrwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlc
    inytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlall
    deecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltkn
    mdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgq
    lykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiricrqgf
    pnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvl
    ahleeerdlki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br2A (A:)
    lvwvpsekhgfeaasievtvelqengkkvtlskddiqkmnppkfskvedmaeltclneas
    vlhnlreryfsgliytysglfcvvinpykqlpiysekiidmykgkkrhempphiyaiadt
    ayrsmlqdredqsilctgesgagktentkkviqylavvasgelekqllqanpileafgna
    ktvkndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliaga
    seqmrndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvs
    svlqlgnivfkkeqasmpdntaaqkvchlmginvtdftrsiltpkaqtkeqadfaieala
    kakferlfrwiltrvnkaldasflgildiagfeifeinsfeqlcinytneklqqlfnhtm
    fileqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecatdtsfvekliq
    eqgnhakfqksktefcilhyagkvtynasawltknmdplndnvtsllnqssdkfvadlwk
    rtvgqlykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiri
    crqgfpnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiff
    rtgvlahleeerd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1br2B (B:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllqanpileafgnaktvk
    ndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqm
    rndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlq
    lgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtke
    qadfaiealakakferlfrwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlc
    inytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlall
    deecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltkn
    mdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgq
    lykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiricrqgf
    pnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvl
    ahleeerdlki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br2B (B:)
    lvwvpsekhgfeaasievtvelqengkkvtlskddiqkmnppkfskvedmaeltclneas
    vlhnlreryfsgliytysglfcvvinpykqlpiysekiidmykgkkrhempphiyaiadt
    ayrsmlqdredqsilctgesgagktentkkviqylavvasgelekqllqanpileafgna
    ktvkndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliaga
    seqmrndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvs
    svlqlgnivfkkeqasmpdntaaqkvchlmginvtdftrsiltpkaqtkeqadfaieala
    kakferlfrwiltrvnkaldasflgildiagfeifeinsfeqlcinytneklqqlfnhtm
    fileqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecatdtsfvekliq
    eqgnhakfqksktefcilhyagkvtynasawltknmdplndnvtsllnqssdkfvadlwk
    rtvgqlykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiri
    crqgfpnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiff
    rtgvlahleeerd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1br2C (C:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllqanpileafgnaktvk
    ndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqm
    rndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlq
    lgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtke
    qadfaiealakakferlfrwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlc
    inytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlall
    deecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltkn
    mdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgq
    lykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiricrqgf
    pnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvl
    ahleeerdlki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br2C (C:)
    lvwvpsekhgfeaasievtvelqengkkvtlskddiqkmnppkfskvedmaeltclneas
    vlhnlreryfsgliytysglfcvvinpykqlpiysekiidmykgkkrhempphiyaiadt
    ayrsmlqdredqsilctgesgagktentkkviqylavvasgelekqllqanpileafgna
    ktvkndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliaga
    seqmrndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvs
    svlqlgnivfkkeqasmpdntaaqkvchlmginvtdftrsiltpkaqtkeqadfaieala
    kakferlfrwiltrvnkaldasflgildiagfeifeinsfeqlcinytneklqqlfnhtm
    fileqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecatdtsfvekliq
    eqgnhakfqksktefcilhyagkvtynasawltknmdplndnvtsllnqssdkfvadlwk
    rtvgqlykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiri
    crqgfpnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiff
    rtgvlahleeerd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1br2D (D:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllqanpileafgnaktvk
    ndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqm
    rndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlq
    lgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtke
    qadfaiealakakferlfrwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlc
    inytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlall
    deecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltkn
    mdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgq
    lykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiricrqgf
    pnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvl
    ahleeerdlki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br2D (D:)
    lvwvpsekhgfeaasievtvelqengkkvtlskddiqkmnppkfskvedmaeltclneas
    vlhnlreryfsgliytysglfcvvinpykqlpiysekiidmykgkkrhempphiyaiadt
    ayrsmlqdredqsilctgesgagktentkkviqylavvasgelekqllqanpileafgna
    ktvkndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliaga
    seqmrndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvs
    svlqlgnivfkkeqasmpdntaaqkvchlmginvtdftrsiltpkaqtkeqadfaieala
    kakferlfrwiltrvnkaldasflgildiagfeifeinsfeqlcinytneklqqlfnhtm
    fileqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecatdtsfvekliq
    eqgnhakfqksktefcilhyagkvtynasawltknmdplndnvtsllnqssdkfvadlwk
    rtvgqlykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiri
    crqgfpnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiff
    rtgvlahleeerd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1br2E (E:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllqanpileafgnaktvk
    ndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqm
    rndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlq
    lgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtke
    qadfaiealakakferlfrwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlc
    inytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlall
    deecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltkn
    mdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgq
    lykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiricrqgf
    pnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvl
    ahleeerdlki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br2E (E:)
    lvwvpsekhgfeaasievtvelqengkkvtlskddiqkmnppkfskvedmaeltclneas
    vlhnlreryfsgliytysglfcvvinpykqlpiysekiidmykgkkrhempphiyaiadt
    ayrsmlqdredqsilctgesgagktentkkviqylavvasgelekqllqanpileafgna
    ktvkndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliaga
    seqmrndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvs
    svlqlgnivfkkeqasmpdntaaqkvchlmginvtdftrsiltpkaqtkeqadfaieala
    kakferlfrwiltrvnkaldasflgildiagfeifeinsfeqlcinytneklqqlfnhtm
    fileqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecatdtsfvekliq
    eqgnhakfqksktefcilhyagkvtynasawltknmdplndnvtsllnqssdkfvadlwk
    rtvgqlykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiri
    crqgfpnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiff
    rtgvlahleeerd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1br2F (F:)
    aqkplsddekflfvdknfvnnplaqadwsakklvwvpsekhgfeaasikeekgdevtvel
    qengkkvtlskddiqkmnppkfskvedmaeltclneasvlhnlreryfsgliytysglfc
    vvinpykqlpiysekiidmykgkkrhempphiyaiadtayrsmlqdredqsilctgesga
    gktentkkviqylavvasshkgkkdtsitqgpsfsygelekqllqanpileafgnaktvk
    ndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliagaseqm
    rndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvssvlq
    lgnivfkkerntdqasmpdntaaqkvchlmginvtdftrsiltprikvgrdvvqkaqtke
    qadfaiealakakferlfrwiltrvnkaldktkrqgasflgildiagfeifeinsfeqlc
    inytneklqqlfnhtmfileqeeyqregiewnfidfgldlqpcielierptnppgvlall
    deecwfpkatdtsfvekliqeqgnhakfqkskqlkdktefcilhyagkvtynasawltkn
    mdplndnvtsllnqssdkfvadlwkdvdrivgldqmakmtesslpsasktkkgmfrtvgq
    lykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiricrqgf
    pnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiffrtgvl
    ahleeerdlki
    

    Sequence, based on observed residues (ATOM records): (download)
    >1br2F (F:)
    lvwvpsekhgfeaasievtvelqengkkvtlskddiqkmnppkfskvedmaeltclneas
    vlhnlreryfsgliytysglfcvvinpykqlpiysekiidmykgkkrhempphiyaiadt
    ayrsmlqdredqsilctgesgagktentkkviqylavvasgelekqllqanpileafgna
    ktvkndnssrfgkfirinfdvtgyivganietylleksrairqakdertfhifyyliaga
    seqmrndlllegfnnytflsnghvpipaqqddemfqetleamtimgfteeeqtsilrvvs
    svlqlgnivfkkeqasmpdntaaqkvchlmginvtdftrsiltpkaqtkeqadfaieala
    kakferlfrwiltrvnkaldasflgildiagfeifeinsfeqlcinytneklqqlfnhtm
    fileqeeyqregiewnfidfgldlqpcielierptnppgvlalldeecatdtsfvekliq
    eqgnhakfqksktefcilhyagkvtynasawltknmdplndnvtsllnqssdkfvadlwk
    rtvgqlykeqltklmttlrntnpnfvrciipnhekragkldahlvleqlrcngvlegiri
    crqgfpnrivfqefrqryeilaanaipkgfmdgkqacilmikaleldpnlyrigqskiff
    rtgvlahleeerd