![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (35 species) not a true protein |
![]() | Species Zebrafish (Danio rerio) [TaxId:7955] [225503] (8 PDB entries) |
![]() | Domain d3db8a_: 3db8 A: [245614] automated match to d4j7ba_ complexed with 1fr |
PDB Entry: 3db8 (more details), 3.15 Å
SCOPe Domain Sequences for d3db8a_:
Sequence, based on SEQRES records: (download)
>d3db8a_ d.144.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} keipdvlvdprtmkrymrgrflgkggfakcyeitdmdtkevfagkvvpksmllkphqkek msteiaihksldnphvvgfhgffedddfvyvvleicrrrsllelhkrrkavtepearyfm rqtiqgvqylhnnrvihrdlklgnlflnddmdvkigdfglatkiefdgerkkdlcgtpny iapevlckkghsfevdiwslgcilytllvgkppfetsclketyirikkneysvprhinpv asalirrmlhadptlrpsvaelltdefftsgyapmrlptscltvppr
>d3db8a_ d.144.1.0 (A:) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]} keipdvlvdprtmkrymrgrflgkggfakcyeitdmdtkevfagkvvpksmllkphqkek msteiaihksldnphvvgfhgffedddfvyvvleicrrrsllelhkrrkavtepearyfm rqtiqgvqylhnnrvihrdlklgnlflnddmdvkigdfglatkihsfevdiwslgcilyt llvgkppfetsclketyirikkneysvprhinpvasalirrmlhadptlrpsvaelltde fftsgyapmrlptscltvppr
Timeline for d3db8a_: