Lineage for d3d2ra1 (3d2r A:21-180)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731436Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1732230Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 1732270Family a.29.5.0: automated matches [230678] (1 protein)
    not a true family
  6. 1732271Protein automated matches [230679] (2 species)
    not a true protein
  7. 1732272Species Human (Homo sapiens) [TaxId:9606] [230680] (8 PDB entries)
  8. 1732279Domain d3d2ra1: 3d2r A:21-180 [245604]
    Other proteins in same PDB: d3d2ra2, d3d2rb2
    automated match to d2bu8a1
    complexed with adp, gol, mg

Details for d3d2ra1

PDB Entry: 3d2r (more details), 2.03 Å

PDB Description: Crystal structure of pyruvate dehydrogenase kinase isoform 4 in complex with ADP
PDB Compounds: (A:) [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4

SCOPe Domain Sequences for d3d2ra1:

Sequence, based on SEQRES records: (download)

>d3d2ra1 a.29.5.0 (A:21-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prevehfsryspsplsmkqlldfgsenacertsfaflrqelpvrlanilkeidilptqlv
ntssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgiie
ykdactvdpvtnqnlqyfldrfymnristrmlmnqhilif

Sequence, based on observed residues (ATOM records): (download)

>d3d2ra1 a.29.5.0 (A:21-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prevehfsryspsplsmkqlldfgsencertsfaflrqelpvrlanilkeidilptqlvn
tssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgiiey
kdacdpvtnqnlqyfldrfymnristrmlmnqhilif

SCOPe Domain Coordinates for d3d2ra1:

Click to download the PDB-style file with coordinates for d3d2ra1.
(The format of our PDB-style files is described here.)

Timeline for d3d2ra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3d2ra2