Lineage for d3cu7a4 (3cu7 A:349-458)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1771547Superfamily b.1.29: Macroglobulin [254121] (8 families) (S)
    C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations
  5. 1771594Family b.1.29.5: Complement C3 MG4-like [254158] (2 proteins)
  6. 1771598Protein Complement C5 MG4 [254355] (1 species)
  7. 1771599Species Human (Homo sapiens) [TaxId:9606] [254788] (1 PDB entry)
  8. 1771600Domain d3cu7a4: 3cu7 A:349-458 [245535]
    Other proteins in same PDB: d3cu7a1, d3cu7a2, d3cu7a3, d3cu7a5, d3cu7a6, d3cu7a7, d3cu7a8, d3cu7a9, d3cu7aa, d3cu7ab, d3cu7ac, d3cu7ad, d3cu7ae, d3cu7af, d3cu7b1, d3cu7b2, d3cu7b3, d3cu7b5, d3cu7b6, d3cu7b7, d3cu7b8, d3cu7b9, d3cu7ba, d3cu7bb, d3cu7bc, d3cu7bd, d3cu7be
    complexed with cd, nag

Details for d3cu7a4

PDB Entry: 3cu7 (more details), 3.1 Å

PDB Description: human complement component 5
PDB Compounds: (A:) Complement C5

SCOPe Domain Sequences for d3cu7a4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cu7a4 b.1.29.5 (A:349-458) Complement C5 MG4 {Human (Homo sapiens) [TaxId: 9606]}
lspyklnlvatplflkpgipypikvqvkdsldqlvggvpvtlnaqtidvnqetsdldpsk
svtrvddgvasfvlnlpsgvtvlefnvktdapdlpeenqaregyraiays

SCOPe Domain Coordinates for d3cu7a4:

Click to download the PDB-style file with coordinates for d3cu7a4.
(The format of our PDB-style files is described here.)

Timeline for d3cu7a4: