Class g: Small proteins [56992] (92 folds) |
Fold g.94: Complement C3 linker domain-like [254109] (1 superfamily) |
Superfamily g.94.1: Complement C3 linker domain-like [254128] (1 family) |
Family g.94.1.1: Complement C3 linker domain-like [254162] (2 proteins) |
Protein Complement C5 linker domain [254365] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254798] (1 PDB entry) |
Domain d3cu7b9: 3cu7 B:607-673 [245555] Other proteins in same PDB: d3cu7a1, d3cu7a2, d3cu7a3, d3cu7a4, d3cu7a5, d3cu7a6, d3cu7a7, d3cu7a8, d3cu7aa, d3cu7ab, d3cu7ac, d3cu7ad, d3cu7ae, d3cu7af, d3cu7b1, d3cu7b2, d3cu7b3, d3cu7b4, d3cu7b5, d3cu7b6, d3cu7b7, d3cu7b8, d3cu7ba, d3cu7bb, d3cu7bc, d3cu7bd, d3cu7be complexed with cd, nag |
PDB Entry: 3cu7 (more details), 3.1 Å
SCOPe Domain Sequences for d3cu7b9:
Sequence; same for both SEQRES and ATOM records: (download)
>d3cu7b9 g.94.1.1 (B:607-673) Complement C5 linker domain {Human (Homo sapiens) [TaxId: 9606]} savygvqrgakkplervfqfleksdlgcgaggglnnanvfhlagltfltnanaddsqend epckeil
Timeline for d3cu7b9: