Lineage for d3cj7a1 (3cj7 A:36-178)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2137193Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2137194Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2138418Family c.55.1.15: NTPDase (Nucleoside triphosphate diphosphohydrolase)-like [254154] (2 proteins)
    Pfam PF01150; relationship to PPX/GPPA (c.55.1.8) discussed in PubMed 18458329
  6. 2138419Protein NTPDase2 [254346] (1 species)
  7. 2138420Species Norway rat (Rattus norvegicus) [TaxId:10116] [254779] (4 PDB entries)
  8. 2138425Domain d3cj7a1: 3cj7 A:36-178 [245489]
    complexed with amp

Details for d3cj7a1

PDB Entry: 3cj7 (more details), 1.8 Å

PDB Description: Structure of Rattus norvegicus NTPDase2 in complex with AMP
PDB Compounds: (A:) Ectonucleoside triphosphate diphosphohydrolase 2

SCOPe Domain Sequences for d3cj7a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3cj7a1 c.55.1.15 (A:36-178) NTPDase2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
palkygivldagsshtsmfvykwpadkendtgivgqhsscdvqgggissyandpskagqs
lvrcleqalrdvprdrhastplylgatagmrllnltspeatarvleavtqtltqypfdfr
garilsgqdegvfgwvtanylle

SCOPe Domain Coordinates for d3cj7a1:

Click to download the PDB-style file with coordinates for d3cj7a1.
(The format of our PDB-style files is described here.)

Timeline for d3cj7a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3cj7a2