Lineage for d3caei_ (3cae I:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2490159Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 2490160Superfamily c.52.1: Restriction endonuclease-like [52980] (37 families) (S)
  5. 2490381Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (2 proteins)
    automatically mapped to Pfam PF05367
  6. 2490396Protein automated matches [254622] (2 species)
    not a true protein
  7. 2490397Species Bacteriophage T7 [TaxId:10760] [256395] (1 PDB entry)
  8. 2490406Domain d3caei_: 3cae I: [245485]
    automated match to d1m0da_

Details for d3caei_

PDB Entry: 3cae (more details), 3 Å

PDB Description: structure of nnqqny as an insert in t7 endonuclease i
PDB Compounds: (I:) endonuclease I

SCOPe Domain Sequences for d3caei_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3caei_ c.52.1.17 (I:) automated matches {Bacteriophage T7 [TaxId: 10760]}
mgledkvskqleskgikfeyeewkvpysnnqqnysshtytpdfllpngifvetkglwesd
drkkhllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikep
kkevpfdrlkrk

SCOPe Domain Coordinates for d3caei_:

Click to download the PDB-style file with coordinates for d3caei_.
(The format of our PDB-style files is described here.)

Timeline for d3caei_: