![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest |
![]() | Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families) ![]() |
![]() | Family c.52.1.17: Endonuclease I (Holliday junction resolvase) [53029] (2 proteins) automatically mapped to Pfam PF05367 |
![]() | Protein automated matches [254622] (2 species) not a true protein |
![]() | Species Bacteriophage T7 [TaxId:10760] [256395] (1 PDB entry) |
![]() | Domain d3caeg_: 3cae G: [245483] automated match to d1m0da_ |
PDB Entry: 3cae (more details), 3 Å
SCOPe Domain Sequences for d3caeg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3caeg_ c.52.1.17 (G:) automated matches {Bacteriophage T7 [TaxId: 10760]} mgledkvskqleskgikfeyeewkvpysnnqqnysshtytpdfllpngifvetkglwesd drkkhllireqhpeldirivfsssrtklykgsptsygefcekhgikfadklipaewikep kkevpfdrlkrk
Timeline for d3caeg_: