SCOPe 2.07: Domain d3c79e1: 3c79 E:1-208

Lineage for d3c79e1 (3c79 E:1-208)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds

4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families)

5. Family b.96.1.0: automated matches [193505] (1 protein)
   not a true family

6. Protein automated matches [193506] (5 species)
   not a true protein

7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)

8. Domain d3c79e1: 3c79 E:1-208 [245469]
   Other proteins in same PDB: d3c79a2, d3c79b2, d3c79c2, d3c79d2, d3c79e2
   automated match to d2c9ta_
   complexed with im4, ipa

Details for d3c79e1

PDB Entry: 3c79, 2.48 Å

PDB Description: Crystal structure of Aplysia californica AChBP in complex with the neonicotinoid imidacloprid

PDB Compounds: (E:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d3c79e1:

Sequence, based on SEQRES records:

>d3c79e1 b.96.1.0 (E:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrw
klnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipa
qrlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsat
qtrqvqhysccpepyidvnlvvkfrerr

Sequence, based on observed residues (ATOM records):

>d3c79e1 b.96.1.0 (E:1-208) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
hsqanlmrlksdlfnrsmypgptkddpltvtlgftlqdivkadsstnevdlvyyeqqrwk
lnslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaq
rlsfmcdptgvdseegatcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatq
trqvqhysccpepyidvnlvvkfrerr

Timeline for d3c79e1:

• d3c79e1 first appeared in SCOPe 2.04, called d3c79e_
  
• d3c79e1 appears in SCOPe 2.06
  
• d3c79e1 appears in the current release, SCOPe 2.08