Lineage for d4gbqa_ (4gbq A:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1120633Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1120634Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1120792Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 1120813Species Mouse (Mus musculus) [TaxId:10090] [50072] (5 PDB entries)
  8. 1120817Domain d4gbqa_: 4gbq A: [24541]
    N-terminal domain

Details for d4gbqa_

PDB Entry: 4gbq (more details)

PDB Description: solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, 15 structures
PDB Compounds: (A:) grb2

SCOPe Domain Sequences for d4gbqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4gbqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Mouse (Mus musculus) [TaxId: 10090]}
meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemkp

SCOPe Domain Coordinates for d4gbqa_:

Click to download the PDB-style file with coordinates for d4gbqa_.
(The format of our PDB-style files is described here.)

Timeline for d4gbqa_: