SCOPe 2.02: Domain d4gbqa_: 4gbq A:

Lineage for d4gbqa_ (4gbq A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.1: SH3-domain [50045] (40 proteins)

6. Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [50072] (5 PDB entries)

8. Domain d4gbqa_: 4gbq A: [24541]
   N-terminal domain

Details for d4gbqa_

PDB Entry: 4gbq

PDB Description: solution nmr structure of the grb2 n-terminal sh3 domain complexed with a ten-residue peptide derived from sos direct refinement against noes, j-couplings, and 1h and 13c chemical shifts, 15 structures

PDB Compounds: (A:) grb2

SCOPe Domain Sequences for d4gbqa_:

Sequence; same for both SEQRES and ATOM records:

>d4gbqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Mouse (Mus musculus) [TaxId: 10090]}
meaiakydfkataddelsfkrgdilkvlneecdqnwykaelngkdgfipknyiemkp

Timeline for d4gbqa_:

• d4gbqa_ first appeared (with stable ids) in SCOP 1.55
  
• d4gbqa_ appears in SCOPe 2.01
  
• d4gbqa_ appears in SCOPe 2.03
  
• d4gbqa_ appears in the current release, SCOPe 2.08