Class a: All alpha proteins [46456] (289 folds) |
Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily) multihelical; bundle, contains interrupted helices |
Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) contains heme-dependent enzymes |
Family a.266.1.0: automated matches [227197] (1 protein) not a true family |
Protein automated matches [226924] (2 species) not a true protein |
Species Xanthomonas campestris [TaxId:340] [232045] (5 PDB entries) |
Domain d3bk9f_: 3bk9 F: [245383] automated match to d3e08a_ complexed with hem, trp; mutant |
PDB Entry: 3bk9 (more details), 2.15 Å
SCOPe Domain Sequences for d3bk9f_:
Sequence, based on SEQRES records: (download)
>d3bk9f_ a.266.1.0 (F:) automated matches {Xanthomonas campestris [TaxId: 340]} tyggylrldqllsaqqplsepahhdemlfiiqaqtselwlkllahelraaivhlqrdevw qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefllgnkn pqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtl rpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgvgf lqqalaltffpelfdvrtsvg
>d3bk9f_ a.266.1.0 (F:) automated matches {Xanthomonas campestris [TaxId: 340]} tyggylrldqllsaqqplsepahhdemlfiiqaqtselwlkllahelraaivhlqrdevw qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefllgnkn pqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyddtlrpvferiyent drywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgvgflqqalaltffp elfdvrtsvg
Timeline for d3bk9f_: