Lineage for d3bk9e_ (3bk9 E:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1509663Fold a.266: Indolic compounds 2,3-dioxygenase-like [140958] (1 superfamily)
    multihelical; bundle, contains interrupted helices
  4. 1509664Superfamily a.266.1: Indolic compounds 2,3-dioxygenase-like [140959] (3 families) (S)
    contains heme-dependent enzymes
  5. 1509692Family a.266.1.0: automated matches [227197] (1 protein)
    not a true family
  6. 1509693Protein automated matches [226924] (2 species)
    not a true protein
  7. 1509711Species Xanthomonas campestris [TaxId:340] [232045] (5 PDB entries)
  8. 1509728Domain d3bk9e_: 3bk9 E: [245382]
    automated match to d3e08a_
    complexed with hem, trp; mutant

Details for d3bk9e_

PDB Entry: 3bk9 (more details), 2.15 Å

PDB Description: h55a mutant of tryptophan 2,3-dioxygenase from xanthomonas campestris
PDB Compounds: (E:) Tryptophan 2,3-dioxygenase

SCOPe Domain Sequences for d3bk9e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bk9e_ a.266.1.0 (E:) automated matches {Xanthomonas campestris [TaxId: 340]}
tyggylrldqllsaqqplsepahhdemlfiiqaqtselwlkllahelraaivhlqrdevw
qcrkvlarskqvlrqlteqwsvletltpseymgfrdvlgpssgfqslqyryiefllgnkn
pqmlqvfaydpagqarlrevleapslyeeflrylarfghaipqqyqardwtaahvaddtl
rpvferiyentdrywreyslcedlvdvetqfqlwrfrhmrtvmrvigfkrgtggssgvgf
lqqalaltffpelfdvrtsv

SCOPe Domain Coordinates for d3bk9e_:

Click to download the PDB-style file with coordinates for d3bk9e_.
(The format of our PDB-style files is described here.)

Timeline for d3bk9e_: