Lineage for d1gfd__ (1gfd -)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.34: SH3-like barrel [50036] (9 superfamilies) 
Superfamily b.34.2: SH3-domain [50044] (1 family) 
Family b.34.2.1: SH3-domain [50045] (18 proteins) 
Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species) Species Human (Homo sapiens) [TaxId:9606] [50071] (6 PDB entries) 
Domain d1gfd__: 1gfd - [24538]
Details for d1gfd__
PDB Entry: 1gfd (more details)
PDB Description: solution structure and ligand-binding site of the c-terminal sh3 domain of grb2
SCOP Domain Sequences for d1gfd__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gfd__ b.34.2.1 (-) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens)}
gstyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr
SCOP Domain Coordinates for d1gfd__:
Click to download the PDB-style file with coordinates for d1gfd__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1gfd__:
- d1gfd__ first appeared (with stable ids) in SCOP 1.55
- d1gfd__ appears in SCOP 1.59
- d1gfd__ appears in the current release, SCOPe 2.08, called d1gfda1
View in 3D