Lineage for d1gfd__ (1gfd -)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 13047Fold b.34: SH3-like barrel [50036] (7 superfamilies)
  4. 13067Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 13068Family b.34.2.1: SH3-domain [50045] (16 proteins)
  6. 13145Protein Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains [50070] (3 species)
  7. 13153Species Human (Homo sapiens) [TaxId:9606] [50071] (5 PDB entries)
  8. 13161Domain d1gfd__: 1gfd - [24538]

Details for d1gfd__

PDB Entry: 1gfd (more details)

PDB Description: solution structure and ligand-binding site of the c-terminal sh3 domain of grb2

SCOP Domain Sequences for d1gfd__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gfd__ b.34.2.1 (-) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens)}
gstyvqalfdfdpqedgelgfrrgdfihvmdnsdpnwwkgachgqtgmfprnyvtpvnr

SCOP Domain Coordinates for d1gfd__:

Click to download the PDB-style file with coordinates for d1gfd__.
(The format of our PDB-style files is described here.)

Timeline for d1gfd__: