SCOPe 2.08: Domain d3awsb_: 3aws B:

Lineage for d3awsb_ (3aws B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.386: Tyrosinase cofactor MelC1-like [254118] (1 superfamily)
   2 layers: a/b; antiparallel beta-sheet of 6 strands partly surrounding one helix. Fold-level similarity and potential homology to SH2 domains (d.93) noted in PubMed 16436386

4. Superfamily d.386.1: Tyrosinase cofactor MelC1 [254141] (2 families)
   Pfam PF06236

5. Family d.386.1.1: Tyrosinase cofactor MelC1 [254186] (2 proteins)

6. Protein Tyrosinase cofactor MelC1 [254410] (1 species)

7. Species Streptomyces castaneoglobisporus [TaxId:79261] [254849] (33 PDB entries)

8. Domain d3awsb_: 3aws B: [245245]
   Other proteins in same PDB: d3awsa1, d3awsa2
   automated match to d2ahkb_
   complexed with cu, no3

Details for d3awsb_

PDB Entry: 3aws, 1.24 Å

PDB Description: Crystal structure of Streptomyces tyrosinase in a complex with caddie soaked in a Cu(II)-containing solution for 20 hr: occupancy of Cu(II) is low

PDB Compounds: (B:) MelC

SCOPe Domain Sequences for d3awsb_:

Sequence, based on SEQRES records:

>d3awsb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpagggahhhehgggyevfvdgvqlhvmrnadgswisvvshyd
pvptpraaaraavdelqgapllpf

Sequence, based on observed residues (ATOM records):

>d3awsb_ d.386.1.1 (B:) Tyrosinase cofactor MelC1 {Streptomyces castaneoglobisporus [TaxId: 79261]}
aapesfdevykgrriqgrpahehgggyevfvdgvqlhvmrnadgswisvvshydpvptpr
aaaraavdelqgapllpf

Timeline for d3awsb_:

• d3awsb_ first appeared in SCOPe 2.04
  
• d3awsb_ appears in SCOPe 2.07