Lineage for d3awsa1 (3aws A:2-273)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719416Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2719417Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2719457Family a.86.1.3: Tyrosinase [254185] (1 protein)
    Pfam PF00264
  6. 2719458Protein Tyrosinase [254409] (1 species)
  7. 2719459Species Streptomyces castaneoglobisporus [TaxId:79261] [254848] (23 PDB entries)
  8. 2719463Domain d3awsa1: 3aws A:2-273 [245244]
    Other proteins in same PDB: d3awsa2, d3awsb_
    automated match to d2ahka_
    complexed with cu, no3

Details for d3awsa1

PDB Entry: 3aws (more details), 1.24 Å

PDB Description: Crystal structure of Streptomyces tyrosinase in a complex with caddie soaked in a Cu(II)-containing solution for 20 hr: occupancy of Cu(II) is low
PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d3awsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3awsa1 a.86.1.3 (A:2-273) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]}
tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
pdvvdlnetmkpwntvrpadlldhtayytfda

SCOPe Domain Coordinates for d3awsa1:

Click to download the PDB-style file with coordinates for d3awsa1.
(The format of our PDB-style files is described here.)

Timeline for d3awsa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3awsa2
View in 3D
Domains from other chains:
(mouse over for more information)
d3awsb_