Lineage for d1prlc_ (1prl C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392487Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2392578Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 2392582Species Chicken (Gallus gallus) [TaxId:9031] [50066] (10 PDB entries)
  8. 2392591Domain d1prlc_: 1prl C: [24524]

Details for d1prlc_

PDB Entry: 1prl (more details)

PDB Description: two binding orientations for peptides to src sh3 domain: development of a general model for sh3-ligand interactions
PDB Compounds: (C:) c-src tyrosine kinase sh3 domain

SCOPe Domain Sequences for d1prlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prlc_ b.34.2.1 (C:) c-src protein tyrosine kinase {Chicken (Gallus gallus) [TaxId: 9031]}
tfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

SCOPe Domain Coordinates for d1prlc_:

Click to download the PDB-style file with coordinates for d1prlc_.
(The format of our PDB-style files is described here.)

Timeline for d1prlc_: