Lineage for d3auhe_ (3auh E:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1702488Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 1702489Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 1702746Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 1702747Protein automated matches [190829] (11 species)
    not a true protein
  7. 1702752Species Cow (Bos taurus) [TaxId:9913] [255754] (5 PDB entries)
  8. 1702755Domain d3auhe_: 3auh E: [245239]
    automated match to d3gymi_
    complexed with so4

Details for d3auhe_

PDB Entry: 3auh (more details), 1.2 Å

PDB Description: A simplified BPTI variant with poly Arg amino acid tag (C3R) at the C-terminus
PDB Compounds: (E:) bovine pancreatic trypsin inhibitor

SCOPe Domain Sequences for d3auhe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3auhe_ g.8.1.0 (E:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaaca

SCOPe Domain Coordinates for d3auhe_:

Click to download the PDB-style file with coordinates for d3auhe_.
(The format of our PDB-style files is described here.)

Timeline for d3auhe_: