SCOPe 2.08: Domain d3auha_: 3auh A:

Lineage for d3auha_ (3auh A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.0: automated matches [191505] (1 protein)
   not a true family

6. Protein automated matches [190829] (14 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [255754] (9 PDB entries)

8. Domain d3auha_: 3auh A: [245237]
   automated match to d3gymi_
   complexed with so4

Details for d3auha_

PDB Entry: 3auh, 1.2 Å

PDB Description: A simplified BPTI variant with poly Arg amino acid tag (C3R) at the C-terminus

PDB Compounds: (A:) bovine pancreatic trypsin inhibitor

SCOPe Domain Sequences for d3auha_:

Sequence; same for both SEQRES and ATOM records:

>d3auha_ g.8.1.0 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaaca

Timeline for d3auha_:

• d3auha_ first appeared in SCOPe 2.04
  
• d3auha_ appears in SCOPe 2.07