Lineage for d3aueg_ (3aue G:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3032519Fold g.8: BPTI-like [57361] (1 superfamily)
    disulfide-rich alpha+beta fold
  4. 3032520Superfamily g.8.1: BPTI-like [57362] (4 families) (S)
  5. 3032807Family g.8.1.0: automated matches [191505] (1 protein)
    not a true family
  6. 3032808Protein automated matches [190829] (14 species)
    not a true protein
  7. 3032821Species Cow (Bos taurus) [TaxId:9913] [255754] (9 PDB entries)
  8. 3032833Domain d3aueg_: 3aue G: [245235]
    Other proteins in same PDB: d3aueb2
    automated match to d3gymi_
    complexed with so4

Details for d3aueg_

PDB Entry: 3aue (more details), 2.28 Å

PDB Description: A simplified BPTI variant with poly His amino acid tag (C5H) at the C-terminus
PDB Compounds: (G:) bovine pancreatic trypsin inhibitor

SCOPe Domain Sequences for d3aueg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3aueg_ g.8.1.0 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaaca

SCOPe Domain Coordinates for d3aueg_:

Click to download the PDB-style file with coordinates for d3aueg_.
(The format of our PDB-style files is described here.)

Timeline for d3aueg_: