Class g: Small proteins [56992] (100 folds) |
Fold g.8: BPTI-like [57361] (1 superfamily) disulfide-rich alpha+beta fold |
Superfamily g.8.1: BPTI-like [57362] (4 families) |
Family g.8.1.0: automated matches [191505] (1 protein) not a true family |
Protein automated matches [190829] (14 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [255754] (9 PDB entries) |
Domain d3aueg_: 3aue G: [245235] Other proteins in same PDB: d3aueb2 automated match to d3gymi_ complexed with so4 |
PDB Entry: 3aue (more details), 2.28 Å
SCOPe Domain Sequences for d3aueg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3aueg_ g.8.1.0 (G:) automated matches {Cow (Bos taurus) [TaxId: 9913]} rpafcleppyagpgkariiryfynaaagaaqafvyggvrakrnnfasaadalaaca
Timeline for d3aueg_:
View in 3D Domains from other chains: (mouse over for more information) d3auea_, d3aueb1, d3aueb2, d3auef_ |