Lineage for d3ajra_ (3ajr A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108924Species Thermoplasma volcanium [TaxId:273116] [194922] (2 PDB entries)
  8. 2108925Domain d3ajra_: 3ajr A: [245158]
    automated match to d2p4hx_
    complexed with mpd, nad, vah

Details for d3ajra_

PDB Entry: 3ajr (more details), 1.77 Å

PDB Description: Crystal structure of L-3-Hydroxynorvaline bound L-Threonine dehydrogenase (Y137F) from Hyperthermophilic Archaeon Thermoplasma volcanium
PDB Compounds: (A:) NDP-sugar epimerase

SCOPe Domain Sequences for d3ajra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ajra_ c.2.1.0 (A:) automated matches {Thermoplasma volcanium [TaxId: 273116]}
milvtgssgqigtelvpylaekygkknviasdivqrdtggikfitldvsnrdeidravek
ysidaifhlagilsakgekdpalaykvnmngtynileaakqhrvekvvipstigvfgpet
pknkvpsititrprtmfgvtkiaaellgqyyyekfgldvrslrypgiisykaeptagttd
yaveifyyavkrekykcylapnralpmmympdalkalvdlyeadrdklvlrngynvtayt
ftpselyskikeripefeieykedfrdkiaatwpesldsseasnewgfsieydldrtidd
midhiseklgiegk

SCOPe Domain Coordinates for d3ajra_:

Click to download the PDB-style file with coordinates for d3ajra_.
(The format of our PDB-style files is described here.)

Timeline for d3ajra_: