Class b: All beta proteins [48724] (149 folds) |
Fold b.34: SH3-like barrel [50036] (15 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (37 proteins) |
Protein c-src protein tyrosine kinase [50064] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [50065] (3 PDB entries) |
Domain d2src_1: 2src 84-145 [24512] Other proteins in same PDB: d2src_2, d2src_3 complexed with anp |
PDB Entry: 2src (more details), 1.5 Å
SCOP Domain Sequences for d2src_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2src_1 b.34.2.1 (84-145) c-src protein tyrosine kinase {Human (Homo sapiens)} ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsi qa
Timeline for d2src_1: