Lineage for d2src_1 (2src 84-145)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 557280Fold b.34: SH3-like barrel [50036] (15 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 557332Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 557333Family b.34.2.1: SH3-domain [50045] (37 proteins)
  6. 557397Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 557411Species Human (Homo sapiens) [TaxId:9606] [50065] (3 PDB entries)
  8. 557413Domain d2src_1: 2src 84-145 [24512]
    Other proteins in same PDB: d2src_2, d2src_3
    complexed with anp

Details for d2src_1

PDB Entry: 2src (more details), 1.5 Å

PDB Description: crystal structure of human tyrosine-protein kinase c-src, in complex with amp-pnp

SCOP Domain Sequences for d2src_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2src_1 b.34.2.1 (84-145) c-src protein tyrosine kinase {Human (Homo sapiens)}
ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsi
qa

SCOP Domain Coordinates for d2src_1:

Click to download the PDB-style file with coordinates for d2src_1.
(The format of our PDB-style files is described here.)

Timeline for d2src_1: