Lineage for d2srca1 (2src A:84-145)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 665027Fold b.34: SH3-like barrel [50036] (18 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 665103Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 665104Family b.34.2.1: SH3-domain [50045] (38 proteins)
  6. 665178Protein c-src protein tyrosine kinase [50064] (3 species)
  7. 665192Species Human (Homo sapiens) [TaxId:9606] [50065] (3 PDB entries)
  8. 665194Domain d2srca1: 2src A:84-145 [24512]
    Other proteins in same PDB: d2srca2, d2srca3
    complexed with anp

Details for d2srca1

PDB Entry: 2src (more details), 1.5 Å

PDB Description: crystal structure of human tyrosine-protein kinase c-src, in complex with amp-pnp
PDB Compounds: (A:) tyrosine-protein kinase src

SCOP Domain Sequences for d2srca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2srca1 b.34.2.1 (A:84-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]}
ttfvalydyesrtetdlsfkkgerlqivnntegdwwlahslstgqtgyipsnyvapsdsi
qa

SCOP Domain Coordinates for d2srca1:

Click to download the PDB-style file with coordinates for d2srca1.
(The format of our PDB-style files is described here.)

Timeline for d2srca1: