| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily) contains large mixed beta-sheet |
Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) ![]() |
| Family d.104.1.3: LplA-like [143642] (6 proteins) part of Pfam PF03099 |
| Protein Two-domain LplA, N-terminal domain [160607] (1 species) |
| Species Escherichia coli [TaxId:562] [160608] (5 PDB entries) Uniprot P32099 1-246 |
| Domain d3a7ac1: 3a7a C:1-246 [245066] Other proteins in same PDB: d3a7aa2, d3a7ab_, d3a7ac2, d3a7ad_ automated match to d3a7ra1 complexed with amp, oct |
PDB Entry: 3a7a (more details), 3.1 Å
SCOPe Domain Sequences for d3a7ac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3a7ac1 d.104.1.3 (C:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]}
stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
wewnfg
Timeline for d3a7ac1:
View in 3DDomains from other chains: (mouse over for more information) d3a7aa1, d3a7aa2, d3a7ab_, d3a7ad_ |