Lineage for d3a7ac1 (3a7a C:1-246)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1920668Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 1920669Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 1920999Family d.104.1.3: LplA-like [143642] (6 proteins)
    part of Pfam PF03099
  6. 1921016Protein Two-domain LplA, N-terminal domain [160607] (1 species)
  7. 1921017Species Escherichia coli [TaxId:562] [160608] (5 PDB entries)
    Uniprot P32099 1-246
  8. 1921028Domain d3a7ac1: 3a7a C:1-246 [245066]
    Other proteins in same PDB: d3a7aa2, d3a7ab_, d3a7ac2, d3a7ad_
    automated match to d3a7ra1
    complexed with amp, oct

Details for d3a7ac1

PDB Entry: 3a7a (more details), 3.1 Å

PDB Description: crystal structure of e. coli lipoate-protein ligase a in complex with octyl-amp and apoh-protein
PDB Compounds: (C:) Lipoate-protein ligase A

SCOPe Domain Sequences for d3a7ac1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3a7ac1 d.104.1.3 (C:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]}
stlrllisdsydpwfnlaveecifrqmpatqrvlflwrnadtvvigraqnpwkecntrrm
eednvrlarrssgggavfhdlgntcftfmagkpeydktistsivlnalnalgvsaeasgr
ndlvvktvegdrkvsgsayretkdrgfhhgtlllnadlsrlanylnpdkkklaakgitsv
rsrvtnltellpgitheqvceaiteaffahygerveaeiispnktpdlpnfaetfarqss
wewnfg

SCOPe Domain Coordinates for d3a7ac1:

Click to download the PDB-style file with coordinates for d3a7ac1.
(The format of our PDB-style files is described here.)

Timeline for d3a7ac1: