Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (6 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.0: automated matches [191474] (1 protein) not a true family |
Protein automated matches [190753] (16 species) not a true protein |
Species Oryza sativa [TaxId:39947] [255730] (1 PDB entry) |
Domain d2zomb_: 2zom B: [244963] automated match to d3opkc_ complexed with gol, so4 |
PDB Entry: 2zom (more details), 3.02 Å
SCOPe Domain Sequences for d2zomb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2zomb_ d.58.5.0 (B:) automated matches {Oryza sativa [TaxId: 39947]} ttvpsivvyvtvpnkeagkrlagsiiseklaacvnivpgiesvywwegkvqtdaeellii ktreslldaltehvkanheydvpevialpikggnlkylewlknstres
Timeline for d2zomb_: