Lineage for d2zmza1 (2zmz A:2-273)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719416Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2719417Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2719457Family a.86.1.3: Tyrosinase [254185] (1 protein)
    Pfam PF00264
  6. 2719458Protein Tyrosinase [254409] (1 species)
  7. 2719459Species Streptomyces castaneoglobisporus [TaxId:79261] [254848] (23 PDB entries)
  8. 2719474Domain d2zmza1: 2zmz A:2-273 [244957]
    Other proteins in same PDB: d2zmza2, d2zmzb_
    automated match to d2ahka_
    complexed with cu1, no3

Details for d2zmza1

PDB Entry: 2zmz (more details), 1.37 Å

PDB Description: The 1.37-A crystal structure of the hydroxylamine-induced deoxy-form of the copper-bound tyrosinase in complex with a caddie protein from Streptomyces castaneoglobisporus
PDB Compounds: (A:) tyrosinase

SCOPe Domain Sequences for d2zmza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2zmza1 a.86.1.3 (A:2-273) Tyrosinase {Streptomyces castaneoglobisporus [TaxId: 79261]}
tvrknqatltadekrrfvaavlelkrsgrydefvrthnefimsdtdsgertghrspsflp
whrrflldfeqalqsvdssvtlpywdwsadrtvraslwapdflggtgrstdgrvmdgpfa
astgnwpinvrvdsrtylrrslggsvaelptraevesvlaisaydlppynsasegfrnhl
egwrgvnlhnrvhvwvggqmatgvspndpvfwlhhayvdklwaewqrrhpdsayvptggt
pdvvdlnetmkpwntvrpadlldhtayytfda

SCOPe Domain Coordinates for d2zmza1:

Click to download the PDB-style file with coordinates for d2zmza1.
(The format of our PDB-style files is described here.)

Timeline for d2zmza1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2zmza2
View in 3D
Domains from other chains:
(mouse over for more information)
d2zmzb_