Lineage for d1bk2__ (1bk2 -)
- Root: SCOP 1.59
Class b: All beta proteins [48724] (110 folds) 
Fold b.34: SH3-like barrel [50036] (9 superfamilies) 
Superfamily b.34.2: SH3-domain [50044] (1 family) 
Family b.34.2.1: SH3-domain [50045] (20 proteins) 
Protein alpha-Spectrin, SH3 domain [50058] (1 species) Species Chicken (Gallus gallus) [TaxId:9031] [50059] (10 PDB entries) 
Domain d1bk2__: 1bk2 - [24495]
Details for d1bk2__
PDB Entry: 1bk2 (more details), 2 Å
PDB Description: a-spectrin sh3 domain d48g mutant
SCOP Domain Sequences for d1bk2__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bk2__ b.34.2.1 (-) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus)}
kelvlalydyqeksprevtmkkgdiltllnstnkdwwkvevngrqgfvpaayvkkld
SCOP Domain Coordinates for d1bk2__:
Click to download the PDB-style file with coordinates for d1bk2__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bk2__:
- d1bk2__ first appeared (with stable ids) in SCOP 1.55
- d1bk2__ appears in SCOP 1.57
- d1bk2__ appears in SCOP 1.61
- d1bk2__ appears in the current release, SCOPe 2.08, called d1bk2a_
View in 3D