SCOPe 2.06: Domain d2yx4a1: 2yx4 A:1-60

Lineage for d2yx4a1 (2yx4 A:1-60)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (68 species)
   not a true protein

7. Species Sulfolobus tokodaii [TaxId:273063] [230698] (7 PDB entries)

8. Domain d2yx4a1: 2yx4 A:1-60 [244868]
   Other proteins in same PDB: d2yx4a2
   automated match to d2efqa1
   complexed with gln, mg

Details for d2yx4a1

PDB Entry: 2yx4, 2 Å

PDB Description: crystal structure of t134a of st1022 from sulfolobus tokodaii

PDB Compounds: (A:) 150aa long hypothetical transcriptional regulator

SCOPe Domain Sequences for d2yx4a1:

Sequence; same for both SEQRES and ATOM records:

>d2yx4a1 a.4.5.0 (A:1-60) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
mdeidlrilkilqynakysldeiareiripkstlsyrikklekdgvikgyyayinpasln

Timeline for d2yx4a1:

• d2yx4a1 first appeared in SCOPe 2.04
  
• d2yx4a1 appears in SCOPe 2.05
  
• d2yx4a1 appears in SCOPe 2.07
  
• d2yx4a1 appears in the current release, SCOPe 2.08