| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) ![]() share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
| Family c.26.2.1: N-type ATP pyrophosphatases [52403] (9 proteins) |
| Protein GMP synthetase, central domain [52404] (2 species) |
| Species Thermus thermophilus HB8 [TaxId:300852] [255716] (2 PDB entries) |
| Domain d2ywca2: 2ywc A:190-382 [244857] Other proteins in same PDB: d2ywca1, d2ywca3, d2ywcb1, d2ywcb3, d2ywcc1, d2ywcc3, d2ywcd1, d2ywcd3 automated match to d1gpma1 complexed with xmp |
PDB Entry: 2ywc (more details), 2.2 Å
SCOPe Domain Sequences for d2ywca2:
Sequence, based on SEQRES records: (download)
>d2ywca2 c.26.2.1 (A:190-382) GMP synthetase, central domain {Thermus thermophilus HB8 [TaxId: 300852]}
wtpehvleellrevreragkdrvllavsggvdsstlalllakagvdhlavfvdhgllrlg
ereevegalralgvnllvvdakerflkalkgvedpeekrkiigrefvaafsqvarergpf
rflaqgtlypdviesagghgaakikshhnvgglpedlefellepfrllfkdevrelalll
glpdtlrlrhpfp
>d2ywca2 c.26.2.1 (A:190-382) GMP synthetase, central domain {Thermus thermophilus HB8 [TaxId: 300852]}
wtpehvleellrevreragkdrvllavsggvdsstlalllakagvdhlavfvdhgllrlg
ereevegalralgvnllvvdakerflkalkgvedpeekrkiigrefvaafsqvarergpf
rflaqgtlypdviegglpedlefellepfrllfkdevrelalllglpdtlrlrhpfp
Timeline for d2ywca2: