SCOPe 2.05: Domain d2ywcb3: 2ywc B:383-503

Lineage for d2ywcb3 (2ywc B:383-503)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies)
   core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta

4. Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (2 families)
   automatically mapped to Pfam PF00958

5. Family d.52.2.1: GMP synthetase C-terminal dimerisation domain [54811] (1 protein)

6. Protein GMP synthetase C-terminal dimerisation domain [54812] (2 species)

7. Species Thermus thermophilus HB8 [TaxId:300852] [255717] (2 PDB entries)

8. Domain d2ywcb3: 2ywc B:383-503 [244861]
   Other proteins in same PDB: d2ywca1, d2ywca2, d2ywcb1, d2ywcb2, d2ywcc1, d2ywcc2, d2ywcd1, d2ywcd2
   automated match to d1gpma3
   complexed with xmp

Details for d2ywcb3

PDB Entry: 2ywc, 2.2 Å

PDB Description: Crystal structure of GMP synthetase from Thermus thermophilus in complex with XMP

PDB Compounds: (B:) GMP synthase [glutamine-hydrolyzing]

SCOPe Domain Sequences for d2ywcb3:

Sequence, based on SEQRES records:

>d2ywcb3 d.52.2.1 (B:383-503) GMP synthetase C-terminal dimerisation domain {Thermus thermophilus HB8 [TaxId: 300852]}
gpglavrvlgevteerleilrraddiftsllrewglyekvaqalavltpvrsvgvagder
kygyvlalravttedfmtadwarlplefldeaarritrrvpeigrvvydltskppatiew
e

Sequence, based on observed residues (ATOM records):

>d2ywcb3 d.52.2.1 (B:383-503) GMP synthetase C-terminal dimerisation domain {Thermus thermophilus HB8 [TaxId: 300852]}
gpglavrvlgevteerleilrraddiftsllrewglyekvaqalavltpvgyvlalravt
tedfmtadwarlplefldeaarritrrvpeigrvvydltskppatiewe

Timeline for d2ywcb3:

• d2ywcb3 first appeared in SCOPe 2.04
  
• d2ywcb3 appears in SCOPe 2.06
  
• d2ywcb3 appears in the current release, SCOPe 2.08