Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.52: Alpha-lytic protease prodomain-like [54805] (10 superfamilies) core: alpha-beta(2)-(alpha)-beta; 2 layers: alpha/beta |
Superfamily d.52.2: GMP synthetase C-terminal dimerisation domain [54810] (2 families) automatically mapped to Pfam PF00958 |
Family d.52.2.1: GMP synthetase C-terminal dimerisation domain [54811] (1 protein) |
Protein GMP synthetase C-terminal dimerisation domain [54812] (2 species) |
Species Thermus thermophilus HB8 [TaxId:300852] [255717] (2 PDB entries) |
Domain d2ywcb3: 2ywc B:383-503 [244861] Other proteins in same PDB: d2ywca1, d2ywca2, d2ywcb1, d2ywcb2, d2ywcc1, d2ywcc2, d2ywcd1, d2ywcd2 automated match to d1gpma3 complexed with xmp |
PDB Entry: 2ywc (more details), 2.2 Å
SCOPe Domain Sequences for d2ywcb3:
Sequence, based on SEQRES records: (download)
>d2ywcb3 d.52.2.1 (B:383-503) GMP synthetase C-terminal dimerisation domain {Thermus thermophilus HB8 [TaxId: 300852]} gpglavrvlgevteerleilrraddiftsllrewglyekvaqalavltpvrsvgvagder kygyvlalravttedfmtadwarlplefldeaarritrrvpeigrvvydltskppatiew e
>d2ywcb3 d.52.2.1 (B:383-503) GMP synthetase C-terminal dimerisation domain {Thermus thermophilus HB8 [TaxId: 300852]} gpglavrvlgevteerleilrraddiftsllrewglyekvaqalavltpvgyvlalravt tedfmtadwarlplefldeaarritrrvpeigrvvydltskppatiewe
Timeline for d2ywcb3: