Lineage for d1pksa_ (1pks A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783416Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1783723Protein Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain [50055] (2 species)
  7. 1783727Species Human (Homo sapiens) [TaxId:9606] [50056] (3 PDB entries)
  8. 1783729Domain d1pksa_: 1pks A: [24484]

Details for d1pksa_

PDB Entry: 1pks (more details)

PDB Description: structure of the pi3k sh3 domain and analysis of the sh3 family
PDB Compounds: (A:) phosphatidylinositol 3-kinase p85-alpha subunit sh3 domain

SCOPe Domain Sequences for d1pksa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pksa_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
egyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqearpeeigwlngynett
gergdfpgtyveyigr

SCOPe Domain Coordinates for d1pksa_:

Click to download the PDB-style file with coordinates for d1pksa_.
(The format of our PDB-style files is described here.)

Timeline for d1pksa_: