![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
![]() | Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
![]() | Family b.34.2.1: SH3-domain [50045] (40 proteins) |
![]() | Protein Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain [50055] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50056] (3 PDB entries) |
![]() | Domain d1pksa_: 1pks A: [24484] |
PDB Entry: 1pks (more details)
SCOPe Domain Sequences for d1pksa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pksa_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} egyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqearpeeigwlngynett gergdfpgtyveyigr
Timeline for d1pksa_: