Lineage for d2yw2a3 (2yw2 A:323-423)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560127Fold b.84: Barrel-sandwich hybrid [51229] (4 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 1560230Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 1560355Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 1560356Protein automated matches [254496] (10 species)
    not a true protein
  7. 1560357Species Aquifex aeolicus [TaxId:63363] [255714] (2 PDB entries)
  8. 1560358Domain d2yw2a3: 2yw2 A:323-423 [244838]
    Other proteins in same PDB: d2yw2a1, d2yw2a2, d2yw2b1, d2yw2b2
    automated match to d1gsoa1
    complexed with atp, po4

Details for d2yw2a3

PDB Entry: 2yw2 (more details), 1.8 Å

PDB Description: Crystal structure of GAR synthetase from Aquifex aeolicus in complex with ATP
PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d2yw2a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yw2a3 b.84.2.0 (A:323-423) automated matches {Aquifex aeolicus [TaxId: 63363]}
eryaldvvlasrgypekpetgkiihgldylksmedvvvfhagtkkegnftvtsggrvlnv
caygktlkeakerayeairyvcfegmhyrkdigdkafkyls

SCOPe Domain Coordinates for d2yw2a3:

Click to download the PDB-style file with coordinates for d2yw2a3.
(The format of our PDB-style files is described here.)

Timeline for d2yw2a3: