Lineage for d2yuya1 (2yuy A:8-120)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2786490Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2786491Protein automated matches [190436] (9 species)
    not a true protein
  7. 2786505Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)
  8. 2786678Domain d2yuya1: 2yuy A:8-120 [244835]
    Other proteins in same PDB: d2yuya2, d2yuya3
    automated match to d3ps4d_

Details for d2yuya1

PDB Entry: 2yuy (more details)

PDB Description: solution structure of pdz domain of rho gtpase activating protein 21
PDB Compounds: (A:) Rho GTPase activating protein 21

SCOPe Domain Sequences for d2yuya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yuya1 b.36.1.0 (A:8-120) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpktvtlkrtsqgfgftlrhfivyppesaiqfsykdeengnrggkqrnrlepmdtifvkq
vkeggpafeaglctgdriikvngesvigktysqvialiqnsdttlelsvmpkd

SCOPe Domain Coordinates for d2yuya1:

Click to download the PDB-style file with coordinates for d2yuya1.
(The format of our PDB-style files is described here.)

Timeline for d2yuya1: