PDB entry 2yuy

View 2yuy on RCSB PDB site
Description: Solution Structure of PDZ domain of Rho GTPase Activating Protein 21
Class: signaling protein
Keywords: PDZ domain, Rho GTPase activating protein 21, NMR, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2007-04-06, released 2008-04-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rho GTPase activating protein 21
    Species: Homo sapiens [TaxId:9606]
    Gene: ARHGAP21
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5T5U3 (7-119)
      • expression tag (0-6)
      • expression tag (120-125)
    Domains in SCOPe 2.08: d2yuya1, d2yuya2, d2yuya3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2yuyA (A:)
    gssgssggpktvtlkrtsqgfgftlrhfivyppesaiqfsykdeengnrggkqrnrlepm
    dtifvkqvkeggpafeaglctgdriikvngesvigktysqvialiqnsdttlelsvmpkd
    sgpssg