| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (9 families) ![]() precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
| Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
| Protein automated matches [226903] (25 species) not a true protein |
| Species Geobacillus kaustophilus [TaxId:1462] [255709] (4 PDB entries) |
| Domain d2ys7a1: 2ys7 A:-1-101 [244815] Other proteins in same PDB: d2ys7a2, d2ys7a3 automated match to d1gsoa2 |
PDB Entry: 2ys7 (more details), 2.21 Å
SCOPe Domain Sequences for d2ys7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ys7a1 c.30.1.0 (A:-1-101) automated matches {Geobacillus kaustophilus [TaxId: 1462]}
hmnvlvigrggrehaiawkaaqsplvgklyvapgnpgiadvaelvhideldiealvqfak
qqaidltivgpeaplasgivdrfmaeglrifgpsqraalieg
Timeline for d2ys7a1: