Lineage for d2abla1 (2abl A:75-139)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536113Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1536114Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1536118Protein Abl tyrosine kinase, SH3 domain [50052] (2 species)
  7. 1536119Species Human (Homo sapiens) [TaxId:9606] [50054] (6 PDB entries)
  8. 1536125Domain d2abla1: 2abl A:75-139 [24481]
    Other proteins in same PDB: d2abla2

Details for d2abla1

PDB Entry: 2abl (more details), 2.5 Å

PDB Description: sh3-sh2 domain fragment of human bcr-abl tyrosine kinase
PDB Compounds: (A:) abl tyrosine kinase

SCOPe Domain Sequences for d2abla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2abla1 b.34.2.1 (A:75-139) Abl tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]}
mgpsendpnlfvalydfvasgdntlsitkgeklrvlgynhngewceaqtkngqgwvpsny
itpvn

SCOPe Domain Coordinates for d2abla1:

Click to download the PDB-style file with coordinates for d2abla1.
(The format of our PDB-style files is described here.)

Timeline for d2abla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2abla2